powered by:
Protein Alignment Mlc-c and CG34434
DIOPT Version :9
Sequence 1: | NP_001245533.1 |
Gene: | Mlc-c / 31474 |
FlyBaseID: | FBgn0004687 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001096887.1 |
Gene: | CG34434 / 31472 |
FlyBaseID: | FBgn0250904 |
Length: | 460 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 15/73 - (20%) |
Similarity: | 27/73 - (36%) |
Gaps: | 13/73 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 KIQLSQVGECLRALGQNPTESDVKKCTHQLKPDERISFEVFLPIYQAISKARSGDTADDFIEGLR 96
|...:::.:||..|....|.|.:.|.|:...|:. :.:...|:.||..:....
Fly 53 KAHFNEMTDCLHKLLTPVTPSSMTKNTNVENPNN-------------LEEMDDGNAADSVVAMDE 104
Fly 97 HFDKDASG 104
..|..|:|
Fly 105 GQDDAATG 112
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Mlc-c | NP_001245533.1 |
PTZ00184 |
14..152 |
CDD:185504 |
15/73 (21%) |
CG34434 | NP_001096887.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0030 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.