DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and CG34434

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001096887.1 Gene:CG34434 / 31472 FlyBaseID:FBgn0250904 Length:460 Species:Drosophila melanogaster


Alignment Length:73 Identity:15/73 - (20%)
Similarity:27/73 - (36%) Gaps:13/73 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KIQLSQVGECLRALGQNPTESDVKKCTHQLKPDERISFEVFLPIYQAISKARSGDTADDFIEGLR 96
            |...:::.:||..|....|.|.:.|.|:...|:.             :.:...|:.||..:....
  Fly    53 KAHFNEMTDCLHKLLTPVTPSSMTKNTNVENPNN-------------LEEMDDGNAADSVVAMDE 104

  Fly    97 HFDKDASG 104
            ..|..|:|
  Fly   105 GQDDAATG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 15/73 (21%)
CG34434NP_001096887.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.