DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and RGD1559821

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_006249352.1 Gene:RGD1559821 / 304447 RGDID:1559821 Length:151 Species:Rattus norvegicus


Alignment Length:141 Identity:71/141 - (50%)
Similarity:96/141 - (68%) Gaps:4/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDER----ISFEVFLPIYQ 77
            ||:|||.|||..|:|||..||.|:.:||||||||.::|.|.....|.||.    :.||.|||:.|
  Rat    11 EFKEAFQLFDRTGNGKILYSQCGDVMRALGQNPTNTEVLKVLGNPKSDEMNVEVLDFEHFLPMLQ 75

  Fly    78 AISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNIN 142
            .::|::...|.:|::|||..|||:.:..:..||:||:|.||||.:|:||||.|:|..||....||
  Rat    76 TVAKSKDQGTYEDYVEGLHVFDKEGNSAVLGAEIRHILVTLGENMTEEEVEMLVAGHEDSNSCIN 140

  Fly   143 YEEFVRMVMSG 153
            |||.||||::|
  Rat   141 YEELVRMVLNG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 70/138 (51%)
RGD1559821XP_006249352.1 PTZ00184 5..149 CDD:185504 69/137 (50%)
EFh 11..75 CDD:298682 33/63 (52%)
EFh 11..39 CDD:197492 16/27 (59%)
EFh 94..148 CDD:298682 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.