DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and cam1

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_593340.1 Gene:cam1 / 2543039 PomBaseID:SPAC3A12.14 Length:150 Species:Schizosaccharomyces pombe


Alignment Length:141 Identity:55/141 - (39%)
Similarity:87/141 - (61%) Gaps:5/141 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDER--ISFEVFLPIYQ 77
            :.||:|||:|||...||.|..:::|..:|:|||:||.::::...:::..|..  |.|..||.:  
pombe    11 IAEFREAFSLFDRDQDGNITSNELGVVMRSLGQSPTAAELQDMINEVDADGNGTIDFTEFLTM-- 73

  Fly    78 AISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANME-DQQGNI 141
            ...|.:..|..::..|..:.||||.:|||:..||.|:||:|||:|:.|||..::...: |..|.|
pombe    74 MARKMKDTDNEEEVREAFKVFDKDGNGYITVEELTHVLTSLGERLSQEEVADMIREADTDGDGVI 138

  Fly   142 NYEEFVRMVMS 152
            |||||.|::.|
pombe   139 NYEEFSRVISS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 54/139 (39%)
cam1NP_593340.1 PTZ00184 5..150 CDD:185504 55/141 (39%)
EFh 13..75 CDD:238008 23/63 (37%)
EFh 86..148 CDD:238008 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.