DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and cdc4

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_594947.1 Gene:cdc4 / 2541699 PomBaseID:SPAP8A3.08 Length:141 Species:Schizosaccharomyces pombe


Alignment Length:138 Identity:55/138 - (39%)
Similarity:91/138 - (65%) Gaps:8/138 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDERISFEVFLPIYQAISKA 82
            :::||:|||..|.|:|..:.:|:.|||.|||||.:::.:....| |.| :..|.||   |.:::.
pombe     8 YKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIESTL-PAE-VDMEQFL---QVLNRP 67

  Fly    83 RSGDTADD---FIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNINYE 144
            ...|...|   |::|.:.|||||:|.|...|||::||:|||||::||:::||..:..:.|.:||.
pombe    68 NGFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPVKDGMVNYH 132

  Fly   145 EFVRMVMS 152
            :||:|:::
pombe   133 DFVQMILA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 55/136 (40%)
cdc4NP_594947.1 PTZ00184 8..141 CDD:185504 55/138 (40%)
EF-hand_6 8..36 CDD:290141 12/27 (44%)
EFh 78..138 CDD:238008 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52059
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23048
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4661
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
55.100

Return to query results.
Submit another query.