DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and Myl6b

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_758463.1 Gene:Myl6b / 216459 MGIID:1917789 Length:207 Species:Mus musculus


Alignment Length:142 Identity:78/142 - (54%)
Similarity:102/142 - (71%) Gaps:4/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE----RISFEVFLPI 75
            ||||:|||.|||..|||||..||.|:.:||||||||.::|.|.....|.:|    |:.||.|||:
Mouse    65 LEEFREAFELFDRVGDGKILYSQCGDLMRALGQNPTNAEVLKVLGNPKNEELKSRRVDFETFLPM 129

  Fly    76 YQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGN 140
            .||::|.|...|.:|::||||.|||:.:|.:..|||||:|||||||:|:||||.:||..||..|.
Mouse   130 LQAVAKNRDQGTYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGC 194

  Fly   141 INYEEFVRMVMS 152
            ||||.|::.::|
Mouse   195 INYEAFLKHILS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 77/140 (55%)
Myl6bNP_758463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
PTZ00184 57..206 CDD:185504 77/140 (55%)
EFh 67..131 CDD:298682 34/63 (54%)
EFh 67..95 CDD:197492 17/27 (63%)
EFh 150..204 CDD:238008 32/53 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850307
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4211
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm42634
orthoMCL 1 0.900 - - OOG6_103928
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4661
SonicParanoid 1 1.000 - - X268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.