DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and mlc-6

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_510375.2 Gene:mlc-6 / 186979 WormBaseID:WBGene00010554 Length:143 Species:Caenorhabditis elegans


Alignment Length:137 Identity:67/137 - (48%)
Similarity:93/137 - (67%) Gaps:1/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDERISFEVFLPIYQAI 79
            :||.:|.|.|||.:|||||..:||.|.||:|.:||..|||.:|..:.....|||||.|||:...:
 Worm     7 MEECREVFMLFDKKGDGKIDAAQVFEVLRSLDENPKNSDVHQCLAKFDKTARISFENFLPVLSHV 71

  Fly    80 SKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNINYE 144
            ...:...:.:|||:||.||||:..|:|:|||||.:|||:|:||:|||.::|:|..|| .|.|..|
 Worm    72 RNNKIPYSMEDFIKGLSHFDKEGEGFITSAELRQVLTTMGDKLSDEEFDKLVAGQED-NGKIKIE 135

  Fly   145 EFVRMVM 151
            .||:.:|
 Worm   136 TFVKTIM 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 67/137 (49%)
mlc-6NP_510375.2 PTZ00184 5..143 CDD:185504 67/137 (49%)
EFh 9..65 CDD:238008 28/55 (51%)
EFh 82..142 CDD:298682 34/60 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167445
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.