DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and cal-7

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_505510.2 Gene:cal-7 / 185545 WormBaseID:WBGene00009585 Length:179 Species:Caenorhabditis elegans


Alignment Length:133 Identity:37/133 - (27%)
Similarity:74/133 - (55%) Gaps:6/133 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQ-LKPDERISFEVFLPIYQAISKAR 83
            :.|.:||...||.|:...|...||:.|.||::::::..:.| .|.:.|:||:..||  :.:...:
 Worm    39 DVFKMFDEDSDGLIETDDVSHVLRSFGLNPSQTELQLVSEQTAKKNGRVSFDDLLP--RVVLAIQ 101

  Fly    84 SGDTADDFIEGLRHFDK--DASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQ-QGNINYEE 145
            :.:..||..:.:....:  .::.|:....|..|||::||.||.:||:|.|.::..: .|:|::..
 Worm   102 NEEWKDDTPKQIHAAFQVITSNNYVQKDTLLQLLTSIGEPLTPQEVKQFLNHVSIRANGDIDWVS 166

  Fly   146 FVR 148
            :|:
 Worm   167 YVK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 37/133 (28%)
cal-7NP_505510.2 PTZ00184 41..169 CDD:185504 36/129 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.