DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and Myl6

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001304146.1 Gene:Myl6 / 17904 MGIID:109318 Length:158 Species:Mus musculus


Alignment Length:132 Identity:70/132 - (53%)
Similarity:91/132 - (68%) Gaps:4/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDER----ISFEVFLPIYQ 77
            ||:|||.|||..|||||..||.|:.:||||||||.::|.|.....|.||.    :.||.|||:.|
Mouse    11 EFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQ 75

  Fly    78 AISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNIN 142
            .::|.:...|.:|::||||.|||:.:|.:..||:||:|.|||||:|:||||.|:|..||..|.||
Mouse    76 TVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCIN 140

  Fly   143 YE 144
            ||
Mouse   141 YE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 70/132 (53%)
Myl6NP_001304146.1 EFh 11..75 CDD:298682 34/63 (54%)
EFh 11..39 CDD:197492 17/27 (63%)
EFh 94..144 CDD:238008 29/49 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850308
Domainoid 1 1.000 44 1.000 Domainoid score I12285
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H69080
Inparanoid 1 1.050 161 1.000 Inparanoid score I4211
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm42634
orthoMCL 1 0.900 - - OOG6_103928
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4661
SonicParanoid 1 1.000 - - X268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.