DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and Myl1

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_067260.1 Gene:Myl1 / 17901 MGIID:97269 Length:188 Species:Mus musculus


Alignment Length:141 Identity:77/141 - (54%)
Similarity:97/141 - (68%) Gaps:4/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE----RISFEVFLPIY 76
            |:|:|||.|||..|:.||.|||||:.|||||.|||.::|||.......:|    :|.||.|||:.
Mouse    47 EDFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMM 111

  Fly    77 QAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNI 141
            ||||..:.....:||:||||.|||:.:|.:..|||||:|.|||||:.:||||.|||..||..|.|
Mouse   112 QAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCI 176

  Fly   142 NYEEFVRMVMS 152
            |||.||:.:||
Mouse   177 NYEAFVKHIMS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 75/139 (54%)
Myl1NP_067260.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
PTZ00184 39..187 CDD:185504 75/139 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4211
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52059
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm42634
orthoMCL 1 0.900 - - OOG6_103928
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4661
SonicParanoid 1 1.000 - - X268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.