DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and Myl3

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001351413.1 Gene:Myl3 / 17897 MGIID:97268 Length:204 Species:Mus musculus


Alignment Length:153 Identity:76/153 - (49%)
Similarity:105/153 - (68%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKQTFT--TLEEFQEAFNLFDN--RGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE--- 65
            :|..||  .:|||:|||.|||.  :|:.||...|.|:.|||||||||:::|.:...:.|.:|   
Mouse    51 IKIEFTPEQIEEFKEAFLLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNS 115

  Fly    66 -RISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQ 129
             .:.||.|||:.|.|||.:...|.:||:||||.|||:.:|.:..|||||:|.||||:||::|||:
Mouse   116 KMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEK 180

  Fly   130 LLANMEDQQGNINYEEFVRMVMS 152
            |:|..||..|.||||.||:.:|:
Mouse   181 LMAGQEDSNGCINYEAFVKHIMA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 72/143 (50%)
Myl3NP_001351413.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
EFh_PEF 53..203 CDD:330173 74/149 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4211
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm42634
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.