DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and Myl4

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_030101494.1 Gene:Myl4 / 17896 MGIID:97267 Length:205 Species:Mus musculus


Alignment Length:143 Identity:75/143 - (52%)
Similarity:101/143 - (70%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EFQEAFNLFDN--RGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE----RISFEVFLPI 75
            ||:|||:|||.  .|:.||...|.|:.|||||||||.::|.:...:.||:|    .:.||:||||
Mouse    63 EFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMSSKTLDFEMFLPI 127

  Fly    76 YQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGN 140
            .|.||:.:...|.:||:||||.|||:::|.:..|||||:|.|||||:::.||||||:..||..|.
Mouse   128 LQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMSEAEVEQLLSGQEDANGC 192

  Fly   141 INYEEFVRMVMSG 153
            ||||.||:.:|||
Mouse   193 INYEAFVKHIMSG 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 72/140 (51%)
Myl4XP_030101494.1 PTZ00184 62..204 CDD:185504 72/140 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850306
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4211
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm42634
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.