DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and mlc-3

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_741145.1 Gene:mlc-3 / 175768 WormBaseID:WBGene00003371 Length:153 Species:Caenorhabditis elegans


Alignment Length:138 Identity:60/138 - (43%)
Similarity:94/138 - (68%) Gaps:3/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQ---LKPDERISFEVFLPIYQAIS 80
            :|.|||:|...||||..:|||:..||.|..||::.|.|...|   .|.::|::||.:||:|:.::
 Worm    10 KEIFNLYDEELDGKIDGTQVGDVARAAGLKPTQAMVTKAAGQEFKRKGEKRLTFEEWLPMYEQLA 74

  Fly    81 KARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGNINYEE 145
            |.:...|..||.|||:.|||:.:|.|.:|||||:|..|||:|:.:|.::||..:||.:|.:.||:
 Worm    75 KEKEQGTYADFYEGLKVFDKEETGKILAAELRHILLALGERLSADEADELLKGVEDGEGMVKYED 139

  Fly   146 FVRMVMSG 153
            |::.|::|
 Worm   140 FIKKVLAG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 59/135 (44%)
mlc-3NP_741145.1 EF-hand_7 9..70 CDD:290234 26/59 (44%)
EFh 90..142 CDD:298682 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.