DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and MYL6B

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001186558.1 Gene:MYL6B / 140465 HGNCID:29823 Length:208 Species:Homo sapiens


Alignment Length:142 Identity:78/142 - (54%)
Similarity:101/142 - (71%) Gaps:4/142 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE----RISFEVFLPI 75
            ||||:|||.|||..|||||..||.|:.:||||||||.::|.|.....|.||    |:.||.|||:
Human    66 LEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPM 130

  Fly    76 YQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGN 140
            .||::|.|...|.:|::||.|.|||:.:|.:..|||||:|||||||:|:||||.:||..||..|.
Human   131 LQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGC 195

  Fly   141 INYEEFVRMVMS 152
            ||||.|::.::|
Human   196 INYEAFLKHILS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 77/140 (55%)
MYL6BNP_001186558.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
PTZ00184 58..207 CDD:185504 77/140 (55%)
EFh 68..132 CDD:298682 35/63 (56%)
EFh 68..96 CDD:197492 17/27 (63%)
EFh 150..205 CDD:238008 32/54 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0030
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4230
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm40563
orthoMCL 1 0.900 - - OOG6_103928
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4661
SonicParanoid 1 1.000 - - X268
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.