DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and AgaP_AGAP006174

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_316234.3 Gene:AgaP_AGAP006174 / 1276842 VectorBaseID:AGAP006174 Length:217 Species:Anopheles gambiae


Alignment Length:138 Identity:36/138 - (26%)
Similarity:67/138 - (48%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKK---CTHQLKPDERISFEVFLPIYQAISK 81
            :||.:||:.|:..:.:.::|..||.||..|||:||.:   .|.....:..:....|||....:..
Mosquito    21 DAFLIFDHHGNKTVDVREIGTILRFLGCVPTEADVNEVISATEFEDSNGTVHLSKFLPYVSQLIA 85

  Fly    82 ARSGDTA--DDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQ-QGNINY 143
            ....:.|  :..::..|..|::..|::....:..|:|..||..|.||:|:::|...|. ...|.|
Mosquito    86 EHKMEPAPPEKLLKAFRVLDQEGKGFVDKEYMTKLITEEGEPFTVEELEEMMAVAVDMATDKIAY 150

  Fly   144 EEFVRMVM 151
            |.::..::
Mosquito   151 ELYLNQLL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 36/138 (26%)
AgaP_AGAP006174XP_316234.3 EFh 21..77 CDD:298682 16/55 (29%)
EFh 96..>140 CDD:298682 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.