DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and AgaP_AGAP004629

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_315188.4 Gene:AgaP_AGAP004629 / 1275902 VectorBaseID:AGAP004629 Length:149 Species:Anopheles gambiae


Alignment Length:138 Identity:45/138 - (32%)
Similarity:74/138 - (53%) Gaps:10/138 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQL-KPDERISFEVFLPIYQA 78
            ::||:|.|.||...|. ...|.::...:|:||.:||   :::.|..| |.:.|:||..||.:...
Mosquito    10 IDEFRECFYLFARSGH-ITTLDELTVIMRSLGLSPT---IQELTQYLKKKNGRMSFADFLEVMHQ 70

  Fly    79 ISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLL--ANMEDQQGNI 141
            .|:..  :..|:.|:..:..||...|.|.:.:|||||...||.|:..||:.:.  ||: ...|::
Mosquito    71 HSRVE--NLPDEVIQAFKAGDKTGRGTIPARQLRHLLQNWGEGLSFREVDNIFREANV-SSNGHV 132

  Fly   142 NYEEFVRM 149
            .|.:|||:
Mosquito   133 RYTDFVRV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 45/138 (33%)
AgaP_AGAP004629XP_315188.4 PTZ00184 1..143 CDD:185504 45/138 (33%)
EFh 12..69 CDD:298682 21/60 (35%)
EFh 80..139 CDD:298682 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.