DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and AgaP_AGAP000927

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_309109.2 Gene:AgaP_AGAP000927 / 1270410 VectorBaseID:AGAP000927 Length:183 Species:Anopheles gambiae


Alignment Length:152 Identity:46/152 - (30%)
Similarity:83/152 - (54%) Gaps:8/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TAHVKQTF--TTLEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDERI 67
            |::|...|  ..:.||:||||:.|...||.|:...:.:.|.:||:||||..::...::....  |
Mosquito    21 TSNVFAMFDQAQIAEFKEAFNMIDQNRDGFIEKDDLHDMLASLGKNPTEEYLEGMMNEAPGP--I 83

  Fly    68 SFEVFLPIYQAISKARSGDTADDFIE-GLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLL 131
            :|.:||.::   .:...|...::.|: ....||::.:|.|:...||.||||:|::.|||:|:::.
Mosquito    84 NFTMFLTLF---GERLQGTDPEEVIKNAFGCFDEENTGVINEDRLRELLTTMGDRFTDEDVDEMF 145

  Fly   132 ANMEDQQGNINYEEFVRMVMSG 153
            .....:....:|.||.|::..|
Mosquito   146 REAPIKNSLFDYIEFTRILKHG 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 42/138 (30%)
AgaP_AGAP000927XP_309109.2 FRQ1 15..170 CDD:227455 46/152 (30%)
EFh 35..>79 CDD:238008 17/43 (40%)
EFh 105..>148 CDD:298682 16/42 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.