DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and MYL12B

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001138416.1 Gene:MYL12B / 103910 HGNCID:29827 Length:172 Species:Homo sapiens


Alignment Length:152 Identity:53/152 - (34%)
Similarity:85/152 - (55%) Gaps:7/152 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TAHVKQTF--TTLEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDERI 67
            |::|...|  :.::||:||||:.|...||.|....:.:.|.:||:|||::.:....::....  |
Human    19 TSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGP--I 81

  Fly    68 SFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLA 132
            :|.:||.::.  .|....|..|........||::|:|.|....||.||||:|::.|||||::|..
Human    82 NFTMFLTMFG--EKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYR 144

  Fly   133 NME-DQQGNINYEEFVRMVMSG 153
            ... |::||.||.||.|::..|
Human   145 EAPIDKKGNFNYIEFTRILKHG 166

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 49/138 (36%)