DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and aff1

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_002941543.3 Gene:aff1 / 100497189 XenbaseID:XB-GENE-5995345 Length:1160 Species:Xenopus tropicalis


Alignment Length:73 Identity:17/73 - (23%)
Similarity:31/73 - (42%) Gaps:7/73 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TAHVKQTFTTLEEFQEAFNLFDNRGDGK-------IQLSQVGECLRALGQNPTESDVKKCTHQLK 62
            ::|.|..:|:|||.|...:..|:....|       ..:.|..:.|:.||.......:|..:...:
 Frog   529 SSHKKSPWTSLEEVQNKEDCPDSPVISKTVTPRQTAGIKQPSKSLKLLGPEEPNVGLKVESEPYR 593

  Fly    63 PDERISFE 70
            |.::.|.|
 Frog   594 PRDQPSKE 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 14/64 (22%)
aff1XP_002941543.3 AF-4 11..485 CDD:398672
AF4_int 714..728 CDD:408645
AF-4_C 897..1159 CDD:408646
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4246
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm47740
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.