powered by:
Protein Alignment Mlc-c and aff1
DIOPT Version :9
Sequence 1: | NP_001245533.1 |
Gene: | Mlc-c / 31474 |
FlyBaseID: | FBgn0004687 |
Length: | 153 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002941543.3 |
Gene: | aff1 / 100497189 |
XenbaseID: | XB-GENE-5995345 |
Length: | 1160 |
Species: | Xenopus tropicalis |
Alignment Length: | 73 |
Identity: | 17/73 - (23%) |
Similarity: | 31/73 - (42%) |
Gaps: | 7/73 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 TAHVKQTFTTLEEFQEAFNLFDNRGDGK-------IQLSQVGECLRALGQNPTESDVKKCTHQLK 62
::|.|..:|:|||.|...:..|:....| ..:.|..:.|:.||.......:|..:...:
Frog 529 SSHKKSPWTSLEEVQNKEDCPDSPVISKTVTPRQTAGIKQPSKSLKLLGPEEPNVGLKVESEPYR 593
Fly 63 PDERISFE 70
|.::.|.|
Frog 594 PRDQPSKE 601
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
151 |
1.000 |
Inparanoid score |
I4246 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000359 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm47740 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X268 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.050 |
|
Return to query results.
Submit another query.