DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and LOC100493285

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:XP_002936019.3 Gene:LOC100493285 / 100493285 -ID:- Length:214 Species:Xenopus tropicalis


Alignment Length:159 Identity:32/159 - (20%)
Similarity:64/159 - (40%) Gaps:31/159 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KQTFTTLEEFQEAFNLFDNRGDGKIQLSQVGECLRALG---QNPTESDVKK-----------CTH 59
            |.|....:|.:..|...|....|.:..::|...|..:|   ....|..:||           |  
 Frog    66 KNTEQESKELRLVFKCVDVNKKGFLNANEVQSALELMGFVINKHGEEHIKKWMDLNKGSLGFC-- 128

  Fly    60 QLKPDERISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTD 124
                    .|:..:..:..:::    |..::..:|....|:|..|.||.::|.......|..|:.
 Frog   129 --------GFQELVADWHGVTR----DFYNELKKGFSLIDQDKDGKISMSDLNAASKMAGIHLSR 181

  Fly   125 EEVEQLLANMEDQQGN--INYEEFVRMVM 151
            :|:|:::|. .||.|:  ::..||:.:::
 Frog   182 QELEEMMAE-ADQNGDRAVDISEFIEIML 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 30/154 (19%)
LOC100493285XP_002936019.3 PTZ00183 68..214 CDD:185503 31/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.