DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mlc-c and zgc:163073

DIOPT Version :9

Sequence 1:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster
Sequence 2:NP_001082980.1 Gene:zgc:163073 / 100037358 ZFINID:ZDB-GENE-070410-135 Length:213 Species:Danio rerio


Alignment Length:143 Identity:73/143 - (51%)
Similarity:98/143 - (68%) Gaps:5/143 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEEFQEAFNLFDNRGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDER----ISFEVFLPI 75
            ||||:|||.||.....| |.|:|.|:.:||||||||.::|.....:.||:|.    |.||.|||:
Zfish    72 LEEFKEAFQLFARSPSG-ISLAQCGDVMRALGQNPTNAEVLNVLGKPKPEEMESKLIDFETFLPM 135

  Fly    76 YQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQLLANMEDQQGN 140
            .|.:||:....:.:||:||||.|||:.:|.:..|||||:|.||||:|::.||:||||..||..|.
Zfish   136 LQQVSKSTESGSFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLSEGEVDQLLAGQEDTNGC 200

  Fly   141 INYEEFVRMVMSG 153
            ||||.|::.||:|
Zfish   201 INYEAFIKHVMAG 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 71/140 (51%)
zgc:163073NP_001082980.1 PTZ00184 70..212 CDD:185504 71/140 (51%)
EFh 150..211 CDD:238008 35/60 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596224
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 162 1.000 Inparanoid score I4192
OMA 1 1.010 - - QHG52059
OrthoDB 1 1.010 - - D1470794at2759
OrthoFinder 1 1.000 - - FOG0000359
OrthoInspector 1 1.000 - - otm24390
orthoMCL 1 0.900 - - OOG6_103928
Panther 1 1.100 - - O PTHR23048
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X268
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.