DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and BEM3

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_015210.1 Gene:BEM3 / 855988 SGDID:S000006036 Length:1128 Species:Saccharomyces cerevisiae


Alignment Length:216 Identity:67/216 - (31%)
Similarity:103/216 - (47%) Gaps:37/216 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VFGTDLTTMVQLEPH-----HQIPFVVRRCVEEV-EARGMLQEGIYRVSGFADEIEALKLALDR- 358
            :||:.|.|.::|..|     :.:|.||.||:|.: :.||:.:|||:|:||.:..|:.|:...|: 
Yeast   904 IFGSSLETCLRLSSHKYQNVYDLPSVVYRCLEYLYKNRGIQEEGIFRLSGSSTVIKTLQERFDKE 968

  Fly   359 ------------EGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSF-MAAGRTGKQA 410
                        |.:..:.|.:.|..||.::|.||||||.||..|...:.:.|| ..........
Yeast   969 YDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKLPHLLFGDEQFLSFKRVVDENHNNP 1033

  Fly   411 EQ-----RQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHM 470
            .|     ::|:...:  :|.|:.|.:..:.|.|.|:..:...||||..||..||:|||       
Yeast  1034 VQISLGFKELIESGL--VPHANLSLMYALFELLVRINENSKFNKMNLRNLCIVFSPTL------- 1089

  Fly   471 TNLTEEIFMLSSLITHCKTIF 491
             |:  .|.||...||....||
Yeast  1090 -NI--PISMLQPFITDFACIF 1107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 65/213 (31%)
BEM3NP_015210.1 PX 520..622 CDD:214610
PH_Bem3 633..741 CDD:270096
RhoGAP 904..1110 CDD:413382 67/216 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.