DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and AT1G08340

DIOPT Version :10

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_172310.1 Gene:AT1G08340 / 837354 AraportID:AT1G08340 Length:331 Species:Arabidopsis thaliana


Alignment Length:219 Identity:58/219 - (26%)
Similarity:95/219 - (43%) Gaps:34/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 VPPKCVPDLKR-----IRGVFGTDLTTMVQLEPHHQ---IPFVVRRCVEEVEARGMLQ-EGIYRV 342
            :|.:..||:.|     ...|||.. |..:||....:   :|.::......:..:|.|| ||::|:
plant    26 LPSEFEPDVPRKAPSASATVFGVS-TESMQLSYDSRGNCVPVILLLLQSRLYDQGGLQAEGVFRI 89

  Fly   343 SGFADEIEALKLALDR----EGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAA 403
            :|...|.|.::..|::    :|.          :|:.:||.:|.:.|.||..::  ...||... 
plant    90 TGENSEEEFVREQLNKGIIPDGI----------DVHCLAGLIKAWFRELPRGVL--DPLPSEQV- 141

  Fly   404 GRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTL--IAT 466
                .|.|..:...:.||.||....|.|.:.:..:..|.....|||||..|||.||||.:  :|.
plant   142 ----MQCESDEDFVKVVRLLPQTEASLLNWAINLMADVIQFEHVNKMNSRNLALVFAPNMSQMAD 202

  Fly   467 PQHMTNLTEEIFMLSSLITHCKTI 490
            |........::..|...:|. ||:
plant   203 PLTALMYAVQVMKLLKSLTE-KTV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_CHN 241..293 CDD:410356 1/5 (20%)
RhoGAP_chimaerin 302..491 CDD:239837 53/199 (27%)
AT1G08340NP_172310.1 PBD 3..37 CDD:197628 3/10 (30%)
RhoGAP 65..217 CDD:238090 44/168 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.