DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and AT4G03100

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_192219.2 Gene:AT4G03100 / 828092 AraportID:AT4G03100 Length:430 Species:Arabidopsis thaliana


Alignment Length:351 Identity:71/351 - (20%)
Similarity:118/351 - (33%) Gaps:129/351 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GKAAAKESKESPAEEKEQKQEEPPPPAVDPMPLV-----------------------------YE 239
            ||...::|.....||:||.|::        :.||                             ..
plant    17 GKGGRRKSTAEEEEEEEQNQQQ--------LSLVEFLLTALRKSVVSCRVDNRQDDGGVGGGISS 73

  Fly   240 KPHHFKV-----------------HTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSEL- 286
            ..||.::                 |.|.||                          .|....|: 
plant    74 AVHHMEIGWPTNVRHITHVTFDRFHGFLGL--------------------------PHELQVEIP 112

  Fly   287 --VPPKCVPDLKRIRGVFGTDLTTMVQL---EPHHQIPFVVRRCVEEV-EARGMLQEGIYRVSGF 345
              ||...|       .|||....:| |.   |..:.:|.::....|.: ..:|:..|||:|::..
plant   113 CRVPSASV-------SVFGVSAESM-QCSYDEKGNSVPTILLLMQERLYSQQGLKAEGIFRINPE 169

  Fly   346 ADEIEALKLALDR--EGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGK 408
            ..:.|.::..|:|  ..|..|        |:.:||.:|.:.|.||..::             .|.
plant   170 NSQEEHVRDQLNRGIVPENID--------VHCLAGLIKAWFRELPSGVL-------------DGL 213

  Fly   409 QAEQ------RQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATP 467
            ..|:      .....|.:::|.|...:.|.:.::.:..|......||||..|:|.||||.:....
plant   214 SPEEVLNCNTEDESVELIKQLKPTESALLNWAVDLMADVVEEEESNKMNARNIAMVFAPNMTQMT 278

  Fly   468 QHMTNL---TEEIFMLSSLITHCKTI 490
            ..:|.|   .:.:.:|.:|||  ||:
plant   279 DPLTALMHAVQVMNLLKTLIT--KTL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 11/71 (15%)
RhoGAP_chimaerin 302..491 CDD:239837 49/204 (24%)
AT4G03100NP_192219.2 PBD 80..113 CDD:197628 6/58 (10%)
RhoGAP 140..298 CDD:214618 39/178 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.