DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and AT3G11490

DIOPT Version :10

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_187756.1 Gene:AT3G11490 / 820322 AraportID:AT3G11490 Length:435 Species:Arabidopsis thaliana


Alignment Length:191 Identity:50/191 - (26%)
Similarity:87/191 - (45%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VFGTDLTTMVQLEPHHQ---IPFVVRRCVEEVEARGMLQ-EGIYRVSGFADEIEALKLALDREGE 361
            |||.. |..:||....:   :|.::......:.:||.|: |||:|::|...:.|.::..|:: |.
plant   135 VFGVS-TESMQLSYDTRGNIVPTILLMMQSHLYSRGGLRVEGIFRINGENGQEEYIREELNK-GI 197

  Fly   362 KTDMSETAYGNVNV--IAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLP 424
            ..|       |::|  :|..:|.:.|.||..::...:....|       ::|......|.||.||
plant   198 IPD-------NIDVHCLASLIKAWFRELPSGVLDSLSPEQVM-------ESESEDECVELVRLLP 248

  Fly   425 PAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEIFMLSSLIT 485
            ....|.|.:.:..:..|.....:||||..|:|.||||.:......:|.|...:.:::.|.|
plant   249 STEASLLDWAINLMADVVEMEQLNKMNARNIAMVFAPNMTQMLDPLTALMYAVQVMNFLKT 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_CHN 241..293 CDD:410356
RhoGAP_chimaerin 302..491 CDD:239837 49/190 (26%)
AT3G11490NP_187756.1 CRIB 91..131 CDD:238077
RhoGAP 154..313 CDD:214618 44/171 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.