DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and ROPGAP3

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_850458.1 Gene:ROPGAP3 / 819283 AraportID:AT2G46710 Length:455 Species:Arabidopsis thaliana


Alignment Length:210 Identity:54/210 - (25%)
Similarity:92/210 - (43%) Gaps:26/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 SEL---VPPKCVPDLKRIRGVFGTDLTTMVQL---EPHHQIPFVVRRCVEEVEARGMLQ-EGIYR 341
            |||   |||: .|...  ..|||....:| |.   :..:.:|.::.|..:.:...|.|: |||:|
plant   130 SELEPEVPPR-APSA
S--VSVFGVSAKSM-QCSYDDRGNSVPTILLRMQKRLYTEGGLKAEGIFR 190

  Fly   342 VSGFADEIEALKLALDREGEKTDMSETAYG-NVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGR 405
            ::....:.|.::..|       :......| :|:.:||.:|.:.|.||..::........|   |
plant   191 INPDNGKEEHVRRQL-------NCGVVPRGIDVHCLAGLIKAWFRELPTGVLDVLTPEQVM---R 245

  Fly   406 TGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHM 470
            ...:.:..:|    |..|||...:.|.:.:..:..|..|...||||..|:|.||||.:......:
plant   246 CNTEEDCSRL----VILLPPVESAILDWAIGLMADVVEHEQFNKMNARNVAMVFAPNMTQMADPL 306

  Fly   471 TNLTEEIFMLSSLIT 485
            |.|...:.:::.|.|
plant   307 TALIHAVQVMNFLKT 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 6/12 (50%)
RhoGAP_chimaerin 302..491 CDD:239837 46/189 (24%)
ROPGAP3NP_850458.1 CRIB 103..143 CDD:238077 7/13 (54%)
RhoGAP 167..323 CDD:238090 42/169 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.