Sequence 1: | NP_727007.1 | Gene: | RhoGAP5A / 31473 | FlyBaseID: | FBgn0029778 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021327566.1 | Gene: | si:dkey-33c9.6 / 795086 | ZFINID: | ZDB-GENE-130530-592 | Length: | 829 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 74/204 - (36%) |
---|---|---|---|
Similarity: | 112/204 - (54%) | Gaps: | 14/204 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 277 FVAHSKCSELVPPKCVPDLKRIRGVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYR 341
Fly 342 VSGFADEIEALKLALD---REGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAA 403
Fly 404 GRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQ 468
Fly 469 HMTNLTEEI 477 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP5A | NP_727007.1 | SH2_a2chimerin_b2chimerin | 75..166 | CDD:198215 | |
C1_1 | 242..294 | CDD:278556 | 5/16 (31%) | ||
RhoGAP_chimaerin | 302..491 | CDD:239837 | 66/179 (37%) | ||
si:dkey-33c9.6 | XP_021327566.1 | RhoGEF | 71..281 | CDD:214619 | |
PH-like | 297..453 | CDD:327399 | |||
C2 | 495..605 | CDD:326325 | 74/204 (36%) | ||
RhoGAP | 624..812 | CDD:295372 | 66/179 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0001164 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |