DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and si:dkey-33c9.6

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_021327566.1 Gene:si:dkey-33c9.6 / 795086 ZFINID:ZDB-GENE-130530-592 Length:829 Species:Danio rerio


Alignment Length:204 Identity:74/204 - (36%)
Similarity:112/204 - (54%) Gaps:14/204 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 FVAHSKCSELVPPKCVPDLKRIRGVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYR 341
            :|.|    .|.||...|.|:  ..||...: ..|.::....:|.:||.||||||.||:.:|||||
Zfish   605 Y
VPH----PLEPPSTTPILQ--EPVFCVPI-GQVAMQESVLVPHIVRSCVEEVERRGLKEEGIYR 662

  Fly   342 VSGFADEIEALKLALD---REGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAA 403
            :||.:.||:|||.|.:   ||.    :|:....:||.::||||||.|.||:|||..:.:.....|
Zfish   663 ISGASTEIQALKYAFNTNYREA----VSKLRSVDVNAVSGTLKLYFRELPLPLIPCEHFSELSDA 723

  Fly   404 GRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQ 468
            ........:...:...::.||..:.:.|.::|.||:|||.....|||:..||||||.|:|:..|.
Zfish   724 LDIADPFVRADSLLSLLQSLPDVNRNTLLFLLHHLRRVAERKEENKMSLSNLATVFGPSLLRPPV 788

  Fly   469 HMTNLTEEI 477
            ...::::|:
Zfish   789 SRVDISQEV 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 5/16 (31%)
RhoGAP_chimaerin 302..491 CDD:239837 66/179 (37%)
si:dkey-33c9.6XP_021327566.1 RhoGEF 71..281 CDD:214619
PH-like 297..453 CDD:327399
C2 495..605 CDD:326325 74/204 (36%)
RhoGAP 624..812 CDD:295372 66/179 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.