DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Arhgap19

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_081943.2 Gene:Arhgap19 / 71085 MGIID:1918335 Length:494 Species:Mus musculus


Alignment Length:211 Identity:58/211 - (27%)
Similarity:106/211 - (50%) Gaps:34/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDM 365
            |||:.||.....:.:..|.::         .:.:..||::||.|.:...:.|:.||: .|...|:
Mouse   112 VFGSPLTEEGIAQIYQLIEYL---------HKNLRVEGLFRVPGNSVRQQLLRDALN-NGTDIDL 166

  Fly   366 SETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFM----------AAGRTGKQAEQRQLMAEAV 420
            ....: :.|.:|..||::|..||.||:|.:.:...:          ...:|....::||:  ||:
Mouse   167 DSGEF-HSNDVATLLKMFLGELPEPLLTHKHFHVHLKIADLMQFDDKGNKTNIPDKERQI--EAL 228

  Fly   421 RR----LPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMT--NLTEEIFM 479
            :.    ||||:.:.|:.:|:.|.:.|.....|||:.||||.:|||.:: .|:::|  :|.|.|..
Mouse   229 QLLFLILPPANRNLLKLLLDLLYQTAKKQDKNKMSAHNLALMFAPHVL-WPKNVTANDLQENIIK 292

  Fly   480 LSS----LITHCKTIF 491
            |::    :|.|.:.:|
Mouse   293 LNTGMAFMIKHSQKLF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 56/208 (27%)
Arhgap19NP_081943.2 RhoGAP_ARHGAP19 113..320 CDD:239857 57/210 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..451
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.