DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Arhgap19

DIOPT Version :10

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_081943.2 Gene:Arhgap19 / 71085 MGIID:1918335 Length:494 Species:Mus musculus


Alignment Length:211 Identity:58/211 - (27%)
Similarity:106/211 - (50%) Gaps:34/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDM 365
            |||:.||.....:.:..|.::         .:.:..||::||.|.:...:.|:.||: .|...|:
Mouse   112 VFGSPLTEEGIAQIYQLIEYL---------HKNLRVEGLFRVPGNSVRQQLLRDALN-NGTDIDL 166

  Fly   366 SETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFM----------AAGRTGKQAEQRQLMAEAV 420
            ....: :.|.:|..||::|..||.||:|.:.:...:          ...:|....::||:  ||:
Mouse   167 DSGEF-HSNDVATLLKMFLGELPEPLLTHKHFHVHLKIADLMQFDDKGNKTNIPDKERQI--EAL 228

  Fly   421 RR----LPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMT--NLTEEIFM 479
            :.    ||||:.:.|:.:|:.|.:.|.....|||:.||||.:|||.:: .|:::|  :|.|.|..
Mouse   229 QLLFLILPPANRNLLKLLLDLLYQTAKKQDKNKMSAHNLALMFAPHVL-WPKNVTANDLQENIIK 292

  Fly   480 LSS----LITHCKTIF 491
            |::    :|.|.:.:|
Mouse   293 LNTGMAFMIKHSQKLF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_CHN 241..293 CDD:410356
RhoGAP_chimaerin 302..491 CDD:239837 56/208 (27%)
Arhgap19NP_081943.2 RhoGAP_ARHGAP19 113..320 CDD:239857 57/210 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..451
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.