Sequence 1: | NP_727007.1 | Gene: | RhoGAP5A / 31473 | FlyBaseID: | FBgn0029778 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081943.2 | Gene: | Arhgap19 / 71085 | MGIID: | 1918335 | Length: | 494 | Species: | Mus musculus |
Alignment Length: | 211 | Identity: | 58/211 - (27%) |
---|---|---|---|
Similarity: | 106/211 - (50%) | Gaps: | 34/211 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 301 VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDM 365
Fly 366 SETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFM----------AAGRTGKQAEQRQLMAEAV 420
Fly 421 RR----LPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMT--NLTEEIFM 479
Fly 480 LSS----LITHCKTIF 491 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP5A | NP_727007.1 | SH2_a2chimerin_b2chimerin | 75..166 | CDD:198215 | |
C1_1 | 242..294 | CDD:278556 | |||
RhoGAP_chimaerin | 302..491 | CDD:239837 | 56/208 (27%) | ||
Arhgap19 | NP_081943.2 | RhoGAP_ARHGAP19 | 113..320 | CDD:239857 | 57/210 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 399..451 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1453 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |