DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and ARHGAP31

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_065805.2 Gene:ARHGAP31 / 57514 HGNCID:29216 Length:1444 Species:Homo sapiens


Alignment Length:177 Identity:55/177 - (31%)
Similarity:95/177 - (53%) Gaps:6/177 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 LKR--IRGVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALD 357
            |||  ....||.|||..:: .....:|:|::.|.|.:|..|:: :||||:||....|:.|:....
Human    10 LKRKGAASAFGCDLTEYLE-SSGQDVPYVLKSCAEFIETHGIV-DGIYRLSGVTSNIQRLRQEFG 72

  Fly   358 REGEKTDMSETAY-GNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVR 421
            .: :..|::...| .:::.:....|||.|.||.||:|::.|..|..|.....:..|...:...::
Human    73 SD-QCPDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVSHCPEEGQLARIQNVIQ 136

  Fly   422 RLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQ 468
            .|||:|:..|:|::.||..:||..:...|:..|||.|:||.|:.:.:
Human   137 ELPPSHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLRSKE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 52/168 (31%)
ARHGAP31NP_065805.2 RhoGAP_CdGAP 17..211 CDD:239849 52/170 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..427
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..631
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 688..893
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 906..1108
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1211..1346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.