DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and RhoGAP1A

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001284725.1 Gene:RhoGAP1A / 5740235 FlyBaseID:FBgn0025836 Length:1404 Species:Drosophila melanogaster


Alignment Length:478 Identity:110/478 - (23%)
Similarity:178/478 - (37%) Gaps:145/478 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 AVEANNLAGRLY--GSEYHGLMGHLEAEQLL------------ANARDGSYFV----RRSPQSDG 114
            |:|..|.....:  |.:|...:..||::.:|            ||.:..::|:    .|:...|.
  Fly   961 AMEVANSGSGAFRSGDKYRRKLADLESQLVLATPNLVLRLGNKANNKTITFFLSSDFERTQWIDS 1025

  Fly   115 YYTLSLRFNKRPKHYKLLYKPG-----------------------VGHYL-RGQDKRFDTVHDMV 155
            ..:|..:.|          .||                       :|.|| |..:.....|.|: 
  Fly  1026 ILSLKQKCN----------LPGANTINSLEVTAFIVAMQKGMKTEMGSYLMRNTNDESLLVGDL- 1079

  Fly   156 ADGLINFHMQLHASPIIQQINQ------------------QTKNCYQQSP------YMTLNG-RK 195
                   :|.:|....::|.|.                  ..|.|..|:|      .:.|.| :.
  Fly  1080 -------YMGVHGLEGLEQANDLYICVEVDSYGHYFRKATTKKICRSQTPLWNESFMLELEGSQN 1137

  Fly   196 LRALSNELGKAAAKESKESPAEEKEQKQEEPPPPAVDPMPLVYEKPHHFKVHTFKGLNWCEFCAN 260
            :|.|..|     |||                       .||:..| |..|:    .|:|......
  Fly  1138 VRILLYE-----AKE-----------------------RPLLKAK-HILKL----SLSWLTETTQ 1169

  Fly   261 FLWGFTAQGVKCE-----ACGFVAHSKCSELVPPKCVPDLKRIRGVFGTDLTTMVQLEPHHQIPF 320
                  .:.:|..     .|.|       ..:|.:......:...:||..::.:::.| ...|||
  Fly  1170 ------PKSIKLTETLELGCSF-------RFIPGELFRGSTKPGALFGAKMSQVLKRE-KRDIPF 1220

  Fly   321 VVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTD--MSETAYGNVNVIAGTLKLY 383
            ::..|:.|||.||||:.|.|||||.|.::..||.|.:.:..:.:  :.|.   :::.:.|.||.:
  Fly  1221 IIGACIREVERRGMLEVGCYRVSGSASDLAKLKKAFESDAYEAEQLLREV---DIHSVTGILKTF 1282

  Fly   384 LRLLPVPLITFQAYPSF---MAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHY 445
            ||.||..|.|.|.||.|   .:|.....::.:...:.:....||.|:.:.:..:|:||.||....
  Fly  1283 LRELPEALFTDQLYPRFFDTFSAFSNNNESTRINELLKVFEELPQANKASITSILDHLIRVHEKE 1347

  Fly   446 AVNKMNEHNLATVFAPTLIATPQ 468
            ..|||:.||||.||.|||:...|
  Fly  1348 TDNKMSLHNLAMVFGPTLLRPGQ 1370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 21/132 (16%)
C1_1 242..294 CDD:278556 8/56 (14%)
RhoGAP_chimaerin 302..491 CDD:239837 60/172 (35%)
RhoGAP1ANP_001284725.1 RhoGEF 675..857 CDD:214619
PH_BCR_arthropod 851..1037 CDD:270174 15/85 (18%)
C2 1079..1187 CDD:301316 26/161 (16%)
RhoGAP 1203..1398 CDD:295372 60/172 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46684
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.