DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap32b

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_009293685.1 Gene:arhgap32b / 569434 ZFINID:ZDB-GENE-091204-147 Length:1956 Species:Danio rerio


Alignment Length:296 Identity:79/296 - (26%)
Similarity:135/296 - (45%) Gaps:56/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 LNGRKLRALSNELGKAAAKESKESPA---------EEKEQKQEEP-PPPAVDPMPLVYEKPHHFK 245
            :|.:..::::|.:.|.|:..|...||         |.:..||:.. .|..::|..|......|.|
Zfish   316 INDKVPQSVTNSVPKPASPCSGLRPASWSLFPPYLEMESIKQDSALAPDPLNPYRLSSVSKKHGK 380

  Fly   246 VHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCVPDLKRI--RG-----VFG 303
            :.|        |...|:                           |..|..:::  ||     |||
Zfish   381 LIT--------FLRTFM---------------------------KSRPTKQKLKQRGILRERVFG 410

  Fly   304 TDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMSET 368
            .||...: |...|.:|.|::.|.|.:|..|:: :|:||:||.|..|:.|:...|.| :..|:::.
Zfish   411 CDLGEHL-LNSGHDVPQVLKSCTEFIEKHGVV-DGMYRLSGIASNIQKLRHEFDSE-QIPDLTKD 472

  Fly   369 AY-GNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQ 432
            .| .:::.:....|||.|.||.||:|:|.|..|..|.......|:...:.:.:::|||.|:..|:
Zfish   473 VYIQDIHCVGSLCKLYFRELPNPLLTYQLYEKFSEAVSAATDEERLIKIHDVIQQLPPPHYRTLE 537

  Fly   433 YMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQ 468
            :::.||..:|:...|..|:..|||.|:||.|:.:.|
Zfish   538 FLMRHLSHLATFSYVTNMHTKNLAIVWAPNLLRSKQ 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 6/51 (12%)
RhoGAP_chimaerin 302..491 CDD:239837 56/168 (33%)
arhgap32bXP_009293685.1 PX_domain 124..238 CDD:295365
SH3_ARHGAP32_33 260..313 CDD:212769
RhoGAP_CdGAP 407..601 CDD:239849 57/170 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.