DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap32a

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_690921.4 Gene:arhgap32a / 562449 ZFINID:ZDB-GENE-060503-918 Length:1676 Species:Danio rerio


Alignment Length:472 Identity:112/472 - (23%)
Similarity:181/472 - (38%) Gaps:132/472 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QLLANARDGSYFVRRSPQSDGYYTLSLRFNKRPKHYKL-LYKPGVGHYLRGQDKRF--------- 148
            |:....|  .:.||||.:         .|....||..| :|           |:||         
Zfish   144 QICCQGR--KWTVRRSYE---------EFRVLDKHLHLCIY-----------DRRFSQLPELPRI 186

  Fly   149 DTVHDMVADGLINFHMQLHASPIIQQINQQTKNCYQQSPYMTLNGRKLRALSNELGK------AA 207
            |::.|..  |.::..:..:.|. :..|.....||.....:|.::.:....|.|:...      ||
Zfish   187 DSLKDKT--GTLSQMLTAYISR-LSAIADNKINCGPALTWMEIDNKGNHLLVNDESSINVPAVAA 248

  Fly   208 AKESKESPAEEKEQKQEEPPPPAVDPMPLVYEKPHHFKVHTFKGLNWCEFCANFLWGFTAQGVKC 272
            |...|...|:..::...|     |..:..|.:.|.......::|.:          ||..     
Zfish   249 AHVIKRYIAQAADELSFE-----VGDIVSVIDMPPKEDTGWWRGKH----------GFQV----- 293

  Fly   273 EACGFVAHSKCSELVPPKCVPD---------------------------------LKRIRG---- 300
               ||.. |:|.||:..| :|.                                 ||: ||    
Zfish   294 ---GFFP-SECVELISEK-IPSNVTSSLAKPVSKKHGKLITFLRTFMKSRPTKQKLKQ-RGILKE 352

  Fly   301 -VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTD 364
             |||.||...: |...|.:|.|:|.|.|.:|..|:: :||||:||.:..|:.|:...|.|.....
Zfish   353 RVFGCDLGEHL-LNSGHDVPQVIRSCTEFIERHGVV-DGIYRLSGISSNIQKLRHEFDSEHVPDL 415

  Fly   365 MSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHS 429
            ..:|...:::.:....|||.|.||.||:|:|.|..|..|.......|:...:.:.:::|||.|:.
Zfish   416 TKDTYVQDIHSVGSLCKLYFRELPNPLLTYQLYEKFSDAVSAATDDERLVKVHDVIQQLPPPHYR 480

  Fly   430 CLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQ-----------------------HMT 471
            .|::::.||.|:.::..|..|:..|||.|:||.|:.:.|                       .:.
Zfish   481 TLEFLMRHLSRMGTYSNVTNMHCKNLAIVWAPNLLRSKQIESACFSGTSAFMEVRVQSVVVEFIL 545

  Fly   472 NLTEEIF--MLSSLITH 486
            |..:.:|  .||:||.|
Zfish   546 NHVDVLFSPKLSTLIRH 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 17/81 (21%)
C1_1 242..294 CDD:278556 10/51 (20%)
RhoGAP_chimaerin 302..491 CDD:239837 63/210 (30%)
arhgap32aXP_690921.4 PX_domain 112..226 CDD:295365 22/106 (21%)
SH3_ARHGAP32_33 248..301 CDD:212769 14/76 (18%)
RhoGAP_CdGAP 353..547 CDD:239849 57/195 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.