DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and myo9ab

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_021326243.1 Gene:myo9ab / 562199 ZFINID:ZDB-GENE-080424-6 Length:2343 Species:Danio rerio


Alignment Length:381 Identity:100/381 - (26%)
Similarity:169/381 - (44%) Gaps:50/381 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 NARDGSYFVRRSPQSDGYYTLSLRFNKRPKHYKLLYKPGVGHYLRGQDKRFDTVHDMVA--DGLI 160
            :|.||        |.|  ..:.:.|.|..|.::|.........|...|.|.....|:.|  :.::
Zfish  1673 DAEDG--------QKD--TAVDVVFKKALKEFRLNIFNSYSTALAMDDGRSIRYKDLYALFEHIL 1727

  Fly   161 NFHMQLH-----ASPIIQQINQQTKNCYQQSPYMTLNGRKLRALSNELGKAAAKESKESPAEEKE 220
            ...|:|.     .||:...:|  |...:... :||    :.:.:...:.||...|.|:...:|.:
Zfish  1728 EKSMRLEQRDWSESPVKVWVN--TFKVFLDE-FMT----EYKPMDGTISKAPKPERKKRRKKESD 1785

  Fly   221 QKQEEPPPPAVDPMPLVYEKPHHFKVHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSE 285
            ..:|              ...|.||...:....:||||::.:| ...:...|:.|.:..|.||..
Zfish  1786 TVEE--------------HMGHIFKSTQYSIPTYCEFCSSLIW-MMDKACVCKLCRYACHKKCCL 1835

  Fly   286 LVPPKCV----PDLKRIRGVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFA 346
            .:..||.    |:|...:  ||.:|:.:...|  ..:|.||.:.:..:|..|:..|||||.||..
Zfish  1836 RMTTKCSKKFDPELSSRQ--FGVELSRLTSDE--RSVPLVVEKLINYIEMHGLYTEGIYRKSGST 1896

  Fly   347 DEIEALKLALDREGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAE 411
            ::|:.||..||.:....::.:.   |::|||..||.:||.||.||:||:.|..|:.|.....:.|
Zfish  1897 NKIKELKQGLDTDANSVNLDDY---NIHVIASVLKQWLRDLPNPLMTFELYEEFLRAMGLQDKRE 1958

  Fly   412 QRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATP 467
            ..|.:...:.:|...|.:.|:.::.||.|::.....|:|:.:.||.||||.::..|
Zfish  1959 VVQGVYSIIDQLSRTHLNTLERLIFHLVRISFQEETNRMSANALAIVFAPCILRCP 2014

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 15/69 (22%)
C1_1 242..294 CDD:278556 15/55 (27%)
RhoGAP_chimaerin 302..491 CDD:239837 55/166 (33%)
myo9abXP_021326243.1 UBQ 7..111 CDD:320785
MYSc_Myo9 163..991 CDD:276836
C1 1793..1841 CDD:237996 13/48 (27%)
RhoGAP_myosin_IXA 1854..2039 CDD:239871 55/166 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.