DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and ARHGAP15

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_060930.3 Gene:ARHGAP15 / 55843 HGNCID:21030 Length:475 Species:Homo sapiens


Alignment Length:188 Identity:53/188 - (28%)
Similarity:104/188 - (55%) Gaps:9/188 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 PDLKRIR-------GVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIE 350
            |.||.::       .:||:.|..:.:.| :..:|:.|::|:|.||.||:..:|||||||....|:
Human   263 PSLKTLQEKGLIKDQIFGSHLHKVCERE-NSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQ 326

  Fly   351 ALKLALDREGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQL 415
            .|:..:::| ||.::.::.:.:::|:.|.||::.|.||.||..:..:..|:.|.:......:.:.
Human   327 KLRFIVNQE-EKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFEQFVEAIKKQDNNTRIEA 390

  Fly   416 MAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNL 473
            :...|::|||.:...::.:..||.::.:..:.|.|:..:|..||.|||:.......|:
Human   391 VKSLVQKLPPPNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNM 448

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215