DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap45a

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_001919378.4 Gene:arhgap45a / 556955 ZFINID:ZDB-GENE-140106-47 Length:1106 Species:Danio rerio


Alignment Length:391 Identity:100/391 - (25%)
Similarity:171/391 - (43%) Gaps:81/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 IIQQINQQTKNCYQ--QSPYMTLN-------GRKLRALSNELGK--------AAAKESKESPAEE 218
            :::|...|.::.:|  :|...||:       |..|.:.:|..|.        :||..|.....||
Zfish   614 VVKQRRGQVRDHHQAHKSWPSTLSDTDSVGPGSGLGSPTNSTGDISKPSRPVSAATLSSNEDLEE 678

  Fly   219 KE--QKQEEPPPPAVDPMPLVYEKPHH-------FKVHTFKGL---NWCEFCANFLWGFTAQGVK 271
            ::  ..|.|.....::|..:....|..       .|.|..:.|   :.|..|.::::   .||.:
Zfish   679 RDGAMTQFEQSINGIEPEIVAPTGPFRNVGLSKAAKTHRLRKLRTPSKCRECDSYVY---FQGAE 740

  Fly   272 CEACGFVAHSKCSELVPPKCVPDLKRIRG---VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARG 333
            ||.|....|.||.|.:..:|  ..|:::|   :||.|.:.::. .....:||::::|:.|:|.|.
Zfish   741 CEECFLACHKKCLESLAIQC--GHKKLQGRLQLFGRDFSQVLH-GKEDAVPFIIKKCITEIERRA 802

  Fly   334 MLQEGIYRVSGFADEIEALKLALDREGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYP 398
            :..:|||||:|....:|.|..|.:...|..::|:   .:.:.|:..||||||.||.|::.|:.|.
Zfish   803 LKMKGIYRVNGVKTRVEKLCQAFENGKELVELSQ---ASPHDISNVLKLYLRQLPEPIMPFRMYN 864

  Fly   399 SFMAAGR---------------------TGKQAEQRQL-----MAEAVRRLPPAHHSCLQYMLEH 437
            ..|...:                     .|.:.|...|     :.|.::|||.|:.:.|:|:::|
Zfish   865 ELMGLAKESLNSDASESTDGVKSPELVDRGPETEAEVLTLVDKLREVLKRLPNANIATLKYIIQH 929

  Fly   438 LKRVASHYAVNKMNEHNLATVFAPTLI------ATPQ--------HMTNLTEEIFMLSSLITHCK 488
            |:||:.....|||:..||..||.|||:      ||..        |...:.|.:.:....|..|.
Zfish   930 LRRVSELEQENKMSASNLGIVFGPTLMRPKPTGATVSLSSLVDYPHQARIVEALIVFQQSIFICT 994

  Fly   489 T 489
            |
Zfish   995 T 995

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 15/61 (25%)
RhoGAP_chimaerin 302..491 CDD:239837 64/228 (28%)
arhgap45aXP_001919378.4 BAR 293..541 CDD:299863
C1 715..760 CDD:197519 13/47 (28%)
RhoGAP 772..986 CDD:295372 61/217 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.