DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Arhgap30

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001102547.1 Gene:Arhgap30 / 498282 RGDID:1561419 Length:1104 Species:Rattus norvegicus


Alignment Length:203 Identity:60/203 - (29%)
Similarity:104/203 - (51%) Gaps:16/203 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDM 365
            |||.||...:| :...::|.|:|.|.|.|:..|:: :||||:||.:..|:.|:...:.| .|.|:
  Rat    17 VFGCDLREHLQ-QSGQEVPQVLRSCAEFVQEYGVV-DGIYRLSGVSSNIQKLRQEFEAE-RKPDL 78

  Fly   366 SETAY-GNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHS 429
            ....| .:::.::...|.|.|.||.||:|::.|..|..|.....:.|:...:.|.::.||..::.
  Rat    79 RRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVAVQLEPERLVKILEVLQELPVPNYR 143

  Fly   430 CLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLI-----------ATPQHMTNLTEEIFMLSSL 483
            .|::::.||..:||..|...|:..|||.|:||.|:           .|...|....:.| ::..:
  Rat   144 TLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRSKDIEASGFNGTAAFMEVRVQSI-VVEFI 207

  Fly   484 ITHCKTIF 491
            :||...:|
  Rat   208 LTHVDQLF 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 58/200 (29%)
Arhgap30NP_001102547.1 RhoGAP_CdGAP 16..210 CDD:239849 57/196 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.