DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap12b

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_021335715.1 Gene:arhgap12b / 393848 ZFINID:ZDB-GENE-040426-1727 Length:882 Species:Danio rerio


Alignment Length:314 Identity:82/314 - (26%)
Similarity:139/314 - (44%) Gaps:72/314 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 RALSN-------ELGKAAAKESKESPAEEKEQKQEEPPPPAVD------PMPLVYEKPHHFKVHT 248
            ||||.       |..:|..::..|||..||..|:::|.....:      .|....:|....|:..
Zfish   603 RALSETINTHAWESDEAIEEDMPESPGSEKHDKEKDPRDSKKNRVVKNSSMESSEQKKTRVKLKK 667

  Fly   249 FKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCVPDLKRIRG-------VFGTDL 306
            |               .|.:                        |.|:.:|.       |||..|
Zfish   668 F---------------LTRR------------------------PTLQAVRDKGYIKDQVFGCSL 693

  Fly   307 TTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMSETAYG 371
            |.:.|.| ...:|..|:.|:|.||..|:..:|:|||||....|:.|:.|::.: ||.::.::.:.
Zfish   694 TALCQRE-GTSVPNFVKMCIEHVENTGLNVDGLYRVSGNLAVIQKLRFAVNHD-EKVNLDDSKWE 756

  Fly   372 NVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLE 436
            :::|..|.||:..|.||.||.|:.::..|:.|.:.....::.|.:.:.:::||..:...::.:.:
Zfish   757 DIHVTTGALKMLFRELPEPLFTYASFNDFVEAIKNSDYKQRVQSIKDLIKQLPKPNQETMKVLFK 821

  Fly   437 HLKRVASHYAVNKMNEHNLATVFAPTLIATPQ--------HMT--NLTEEIFML 480
            |||||..|..||:|...::|.||.|||: .|:        ||.  |...|:.:|
Zfish   822 HLKRVIDHGEVNRMTTQSVAIVFGPTLL-RPEIETGNMAVHMVYQNQIVELILL 874

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 3/51 (6%)
RhoGAP_chimaerin 302..491 CDD:239837 60/189 (32%)
arhgap12bXP_021335715.1 SH3_ARHGAP12 17..76 CDD:213003
SH3-WW_linker 73..267 CDD:318759
WW 271..297 CDD:306827
WW 364..389 CDD:306827
PH_ARHGAP9-like 459..611 CDD:270053 4/7 (57%)
RhoGAP_ARHGAP27_15_12_9 689..875 CDD:239868 60/189 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.