DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and arhgap4a

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_956738.1 Gene:arhgap4a / 393416 ZFINID:ZDB-GENE-040426-1229 Length:917 Species:Danio rerio


Alignment Length:221 Identity:58/221 - (26%)
Similarity:95/221 - (42%) Gaps:24/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 VAHSKCSELVPPKCVPDLKRIRGVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRV 342
            |.|.|.:        |..:..:.:|..||.:.:|.. ...||.||..|:..:...|:..||::||
Zfish   457 VRHKKSN--------PGSQINQKLFNGDLLSYIQAS-GQLIPAVVESCIRFINLNGLHHEGLFRV 512

  Fly   343 SGFADEIEALKLALDR-----EGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMA 402
            .|....:..||.|.::     ..|:.||..        :||.||||.|.|..||....:|...|.
Zfish   513 PGSQMVVNQLKDAFEKGDDPLTDERCDMDS--------VAGVLKLYFRGLEKPLFPEDSYDQLME 569

  Fly   403 AGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATP 467
            .|:...:.::...:...|...||:....::|:...|..|:.:...|.|..:|||..|.|:|:..|
Zfish   570 CGQIDDETKKVTQLKLIVSSYPPSLIIVMRYLFAFLHHVSQYSDENMMQPYNLAVCFGPSLVRGP 634

  Fly   468 QH--MTNLTEEIFMLSSLITHCKTIF 491
            .:  ...|.....::.|:|...::||
Zfish   635 NNGDAAELQRINALVKSIIIRHESIF 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 3/15 (20%)
RhoGAP_chimaerin 302..491 CDD:239837 52/195 (27%)
arhgap4aNP_956738.1 F-BAR_srGAP 27..252 CDD:153340
RhoGAP_srGAP 471..655 CDD:239848 52/192 (27%)
SH3_srGAP4 704..758 CDD:212889
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.