DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Arhgap32

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_006510505.1 Gene:Arhgap32 / 330914 MGIID:2450166 Length:2103 Species:Mus musculus


Alignment Length:405 Identity:99/405 - (24%)
Similarity:167/405 - (41%) Gaps:75/405 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 SYFVRRSPQSDGYYTLSLRFNKRPKHYKL-LYKPGVGHYLRGQDKRFDTVHDMVADGLINFHMQL 166
            |:.|:||.:.         |....||..| :|           |:||..:.::....:      |
Mouse   180 SWIVKRSYED---------FRVLDKHLHLCIY-----------DRRFSQLTELPRSDV------L 218

  Fly   167 HASP--IIQQINQQTK----------NCYQQSPYMTLNGRKLRALSNE--------LGKA----- 206
            ..||  :.|.:.....          ||.....:|.::.:....|.:|        :|.|     
Mouse   219 KDSPESVTQMLTAYLSRLSTIAGNKINCGPALTWMEIDNKGNHLLVHEESSINTPAVGAAHVIKR 283

  Fly   207 -AAKESKESPAEEKEQKQEEPPPPAVDPMPLVYEKPHHFKVHTFKGLNWCEFCANFLWGFTAQGV 270
             .|:...|...|..:.......||.|  :...:...|.|:|..|.|     .|...:.....|.|
Mouse   284 YTARAPDELTLEVGDIVSVIDMPPKV--LSTWWRGKHGFQVGLFPG-----HCVELINQKVPQSV 341

  Fly   271 KCEACGFVA--HSKCSELVPP--KCVPDLKRI--RG-----VFGTDLTTMVQLEPHHQIPFVVRR 324
            .......|:  |.|....:..  |..|..:::  ||     |||.||...: |....::|.|::.
Mouse   342 TNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLKQRGILKERVFGCDLGEHL-LNSGFEVPQVLQS 405

  Fly   325 CVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMSETAY-GNVNVIAGTLKLYLRLLP 388
            |...:|..|:: :||||:||.|..|:.|:...|.| ...|:::..| .:::.:....|||.|.||
Mouse   406 CTAFIERYGIV-DGIYRLSGVASNIQRLRHEFDSE-HVPDLTKEPYVQDIHSVGSLCKLYFRELP 468

  Fly   389 VPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEH 453
            .||:|:|.|..|..|.......|:...:.:.:::|||.|:..|::::.||..:|.:.::..|:..
Mouse   469 NPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMHAK 533

  Fly   454 NLATVFAPTLIATPQ 468
            |||.|:||.|:.:.|
Mouse   534 NLAIVWAPNLLRSKQ 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 12/63 (19%)
C1_1 242..294 CDD:278556 12/55 (22%)
RhoGAP_chimaerin 302..491 CDD:239837 54/168 (32%)
Arhgap32XP_006510505.1 PX_RICS 141..255 CDD:132831 19/100 (19%)
SH3_ARHGAP32_33 277..330 CDD:212769 12/59 (20%)
RhoGAP_CdGAP 382..576 CDD:239849 55/170 (32%)
PHA03247 <1251..1633 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.