DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Graf

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001285296.1 Gene:Graf / 32522 FlyBaseID:FBgn0030685 Length:1025 Species:Drosophila melanogaster


Alignment Length:214 Identity:69/214 - (32%)
Similarity:107/214 - (50%) Gaps:24/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 IRGVFGTDLTTMVQ-----LEPHH--QIPFV-VRRCVEEVEARGMLQEGIYRVSGFADEIEALKL 354
            |..:.||:.|.:..     .|.:|  :..|: :|||::.:|.||:..|||||.||...:|..| |
  Fly   380 ISAMDGTEPTYLAPGKIKVSEAYHLDEAGFMFIRRCIQVLEIRGLEDEGIYRKSGVGTKISKL-L 443

  Fly   355 ALDREGEKTD--MSETAYGNV---NVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQ 414
            ||....:::|  ..:..|.::   |.||..||:|||.|..||:|:|.:..|:.|   .||....|
  Fly   444 ALGLNQKESDDVFVDDKYRDLMESNTIASALKMYLRNLNEPLMTYQYHSDFIEA---AKQETLNQ 505

  Fly   415 LMAEA---VRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEE 476
            .:.|.   |.:||..:...|..::.||..|:..|..|||:..||..||.|||:...:.......:
  Fly   506 RVNEVHKLVYKLPQPNFQMLDMVICHLTDVSRKYEKNKMSVFNLGVVFGPTLLRPREESVAAILD 570

  Fly   477 I----FMLSSLITHCKTIF 491
            |    .:::.||.:.:.||
  Fly   571 IKFNNIVINILIDNYERIF 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 66/208 (32%)
GrafNP_001285296.1 BAR_RhoGAP_OPHN1-like 27..233 CDD:153286
BAR-PH_GRAF_family 273..390 CDD:269953 3/9 (33%)
PH 279..383 CDD:278594 1/2 (50%)
RhoGAP 383..584 CDD:295372 66/204 (32%)
SH3_GRAF-like 967..1020 CDD:212815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.