Sequence 1: | NP_727007.1 | Gene: | RhoGAP5A / 31473 | FlyBaseID: | FBgn0029778 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285296.1 | Gene: | Graf / 32522 | FlyBaseID: | FBgn0030685 | Length: | 1025 | Species: | Drosophila melanogaster |
Alignment Length: | 214 | Identity: | 69/214 - (32%) |
---|---|---|---|
Similarity: | 107/214 - (50%) | Gaps: | 24/214 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 298 IRGVFGTDLTTMVQ-----LEPHH--QIPFV-VRRCVEEVEARGMLQEGIYRVSGFADEIEALKL 354
Fly 355 ALDREGEKTD--MSETAYGNV---NVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQ 414
Fly 415 LMAEA---VRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEE 476
Fly 477 I----FMLSSLITHCKTIF 491 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP5A | NP_727007.1 | SH2_a2chimerin_b2chimerin | 75..166 | CDD:198215 | |
C1_1 | 242..294 | CDD:278556 | |||
RhoGAP_chimaerin | 302..491 | CDD:239837 | 66/208 (32%) | ||
Graf | NP_001285296.1 | BAR_RhoGAP_OPHN1-like | 27..233 | CDD:153286 | |
BAR-PH_GRAF_family | 273..390 | CDD:269953 | 3/9 (33%) | ||
PH | 279..383 | CDD:278594 | 1/2 (50%) | ||
RhoGAP | 383..584 | CDD:295372 | 66/204 (32%) | ||
SH3_GRAF-like | 967..1020 | CDD:212815 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1094 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |