DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Arhgap32

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_017451485.1 Gene:Arhgap32 / 315530 RGDID:1305267 Length:2100 Species:Rattus norvegicus


Alignment Length:407 Identity:99/407 - (24%)
Similarity:167/407 - (41%) Gaps:79/407 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 SYFVRRSPQSDGYYTLSLRFNKRPKHYKL-LYKPGVGHYLRGQDKRFDTVHDMVADGLINFHMQL 166
            |:.|:||.:.         |....||..| :|           |:||..:.::....:      |
  Rat   180 SWIVKRSYED---------FRVLDKHLHLCIY-----------DRRFSQLSELPRSDI------L 218

  Fly   167 HASPIIQQINQQTK--------------NCYQQSPYMTLNGRKLRALSNE--------LGKA--- 206
            ..||  :.:.|...              ||.....:|.::.:....|.:|        :|.|   
  Rat   219 KDSP--ESVTQMLAAYLSRLSTIAGNKINCGPALTWMEIDNKGNHLLVHEESSINTPAVGAAHVI 281

  Fly   207 ---AAKESKESPAEEKEQKQEEPPPPAVDPMPLVYEKPHHFKVHTFKGLNWCEFCANFLWGFTAQ 268
               .|:...|...|..:.......||.|  :...:...|.|:|..|.|     .|...:.....|
  Rat   282 KRYTARAPDELTLEVGDIVSVIDMPPKV--LSTWWRGKHGFQVGLFPG-----HCVELINQKVPQ 339

  Fly   269 GVKCEACGFVA--HSKCSELVPP--KCVPDLKRI--RG-----VFGTDLTTMVQLEPHHQIPFVV 322
            .|.......|:  |.|....:..  |..|..:::  ||     |||.||...: |....::|.|:
  Rat   340 SVTNSVPKPVSKKHGKLITFLRTFMKSRPTKQKLKQRGILKERVFGCDLGEHL-LNSGFEVPQVL 403

  Fly   323 RRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMSETAY-GNVNVIAGTLKLYLRL 386
            :.|...:|..|:: :||||:||.|..|:.|:...|.| ...|:::..| .:::.:....|||.|.
  Rat   404 QSCTAFIERYGIV-DGIYRLSGVASNIQRLRHEFDSE-HVPDLTKEPYVQDIHSVGSLCKLYFRE 466

  Fly   387 LPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMN 451
            ||.||:|:|.|..|..|.......|:...:.:.:::|||.|:..|::::.||..:|.:.::..|:
  Rat   467 LPNPLLTYQLYEKFSDAVSAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHLSLLADYCSITNMH 531

  Fly   452 EHNLATVFAPTLIATPQ 468
            ..|||.|:||.|:.:.|
  Rat   532 AKNLAIVWAPNLLRSKQ 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 12/63 (19%)
C1_1 242..294 CDD:278556 12/55 (22%)
RhoGAP_chimaerin 302..491 CDD:239837 54/168 (32%)
Arhgap32XP_017451485.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.