DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Arhgap12

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001100827.2 Gene:Arhgap12 / 307016 RGDID:1310017 Length:838 Species:Rattus norvegicus


Alignment Length:334 Identity:86/334 - (25%)
Similarity:156/334 - (46%) Gaps:56/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 IIQQINQQTKNCYQQSPYMTLNGRKLRALSNELGKAAAKESKESPAEEKEQKQEEPPPPAVDPMP 235
            :||..|....|.:.:....|:|.:..     |..:||.:|:.:||..||:.|::           
  Rat   546 LIQSDNDAVINDWFKVLSSTINNQVA-----EADEAAEEEAPDSPGVEKQDKEK----------- 594

  Fly   236 LVYEKPHHFKVHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCVPDLKRIR- 299
               ::....|:.:.||        :.:.....:..|.....|:...           |.|:.:| 
  Rat   595 ---DQKELKKLRSMKG--------SSMDSSEQKKTKKNLKKFLTRR-----------PTLQAVRE 637

  Fly   300 ------GVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDR 358
                  .|||::|..:.|.| :..:|..|:.|:|.||..|:..:|||||||....|:.|:.|::.
  Rat   638 KGYIKDQVFGSNLANLCQRE-NGTVPKFVKLCIEHVEEHGLDVDGIYRVSGNLAVIQKLRFAVNH 701

  Fly   359 EGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMA--EAVR 421
            : ||.|::::.:.:::||.|.||::.|.||.||.||..:..|:.|   .||..::::.|  :.:|
  Rat   702 D-EKLDLNDSKWEDIHVITGALKMFFRELPEPLFTFNHFNDFVNA---IKQEPRQRVTAVKDLIR 762

  Fly   422 RLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEIF----MLSS 482
            :||..:...:|.:..|||||..:...|:|...::|.||.|||:...:...|:.....    ::..
  Rat   763 QLPKPNQDTMQILFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPERETGNIAVHTVYQNQIVEL 827

  Fly   483 LITHCKTIF 491
            ::....|:|
  Rat   828 ILLELSTVF 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 5/51 (10%)
RhoGAP_chimaerin 302..491 CDD:239837 61/194 (31%)
Arhgap12NP_001100827.2 SH3_ARHGAP12 13..72 CDD:213003
SH3-WW_linker 69..264 CDD:406914
WW 266..296 CDD:238122
PH_ARHGAP9-like 457..568 CDD:270053 5/21 (24%)
RhoGAP_ARHGAP27_15_12_9 646..831 CDD:239868 60/189 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.