DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Myo9a

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_006511271.1 Gene:Myo9a / 270163 MGIID:107735 Length:2633 Species:Mus musculus


Alignment Length:359 Identity:97/359 - (27%)
Similarity:165/359 - (45%) Gaps:48/359 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 LRGQDKRFDTVHDMV-ADGLINFHMQLHAS-------------------PIIQQINQQTKNCYQ- 184
            |..:|.:.||:.|:| ...|..|...:.:|                   .:.:||.::|....| 
Mouse  1954 LDNEDSKKDTLVDVVFKKALKEFRQNIFSSYSSALAMDDGKSIRYKDLYALFEQILEKTMRLEQR 2018

  Fly   185 ---QSPY-MTLNGRK--LRALSNELGKAAAKESKESPAEEKEQKQEEPPPPAVDPMPLVYE-KPH 242
               :||. :.:|..|  |....||.....:...|....|.|:::::|        ..||.| ..|
Mouse  2019 DWNESPVRVWVNTFKVFLDEYMNEFKTLDSTAPKVLKTERKKRRKKE--------TDLVEEHNGH 2075

  Fly   243 HFKVHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCV----PDLKRIRGVFG 303
            .||...:....:||:|::.:|......| |:.|.:..|.||......||.    |:|...:  ||
Mouse  2076 IFKATQYSIPTYCEYCSSLIWIMDRASV-CKLCKYACHKKCCLKTTAKCSKKYDPELSSRQ--FG 2137

  Fly   304 TDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMSET 368
            .:|:.:...:  ..:|.||.:.:..:|..|:..|||||.||..::|:.|:..||.:.|..::.:.
Mouse  2138 VELSRLTSED--RAVPLVVEKLINYIEMHGLYTEGIYRKSGSTNKIKELRQGLDTDAESVNLDDY 2200

  Fly   369 AYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQY 433
               |::|||...|.:||.||.||:||:.|..|:.|....::.|..:.:...:.:|...|.:.|:.
Mouse  2201 ---NIHVIASVFKQWLRDLPNPLMTFELYEEFLRAMGLQERKETIRGVYSVIDQLSRTHLNTLER 2262

  Fly   434 MLEHLKRVASHYAVNKMNEHNLATVFAPTLIATP 467
            ::.||.|:|.....|:|:.:.||.||||.::..|
Mouse  2263 LIFHLVRIALQEDTNRMSANALAIVFAPCILRCP 2296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215 8/25 (32%)
C1_1 242..294 CDD:278556 15/55 (27%)
RhoGAP_chimaerin 302..491 CDD:239837 53/166 (32%)
Myo9aXP_006511271.1 RA_Myosin-IXa 15..110 CDD:340736
MYSc_Myo9 160..1006 CDD:276836
DUF5401 <968..>1283 CDD:375164
IQ 1117..1138 CDD:197470
PEHE <1827..1891 CDD:373705
C1 2075..2123 CDD:237996 13/48 (27%)
RhoGAP_myosin_IX 2136..2321 CDD:239842 53/166 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.