DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and ARHGAP30

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001020769.1 Gene:ARHGAP30 / 257106 HGNCID:27414 Length:1101 Species:Homo sapiens


Alignment Length:205 Identity:64/205 - (31%)
Similarity:105/205 - (51%) Gaps:20/205 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDM 365
            |||.||...:| ....::|.|::.|.|.||..|:: :||||:||.:..|:.|:...:.| .|.|:
Human    17 VFGCDLQEHLQ-HSGQEVPQVLKSCAEFVEEYGVV-DGIYRLSGVSSNIQKLRQEFESE-RKPDL 78

  Fly   366 SETAY-GNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQL--MAEAVRRLPPAH 427
            ....| .:::.::...|.|.|.||.||:|::.|..|..|  .|.|.|..:|  :.|.:|.||..:
Human    79 RRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEA--VGVQLEPERLVKILEVLRELPVPN 141

  Fly   428 HSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLI-----------ATPQHMTNLTEEIFMLS 481
            :..|::::.||..:||..|...|:..|||.|:||.|:           .|...|....:.| ::.
Human   142 YRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRSKDIEASGFNGTAAFMEVRVQSI-VVE 205

  Fly   482 SLITHCKTIF 491
            .::||...:|
Human   206 FILTHVDQLF 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 62/202 (31%)
ARHGAP30NP_001020769.1 RhoGAP_CdGAP 16..210 CDD:239849 61/198 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..243
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 300..400
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..529
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 621..906
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 965..991
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1050..1101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.