Sequence 1: | NP_727007.1 | Gene: | RhoGAP5A / 31473 | FlyBaseID: | FBgn0029778 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001020769.1 | Gene: | ARHGAP30 / 257106 | HGNCID: | 27414 | Length: | 1101 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 64/205 - (31%) |
---|---|---|---|
Similarity: | 105/205 - (51%) | Gaps: | 20/205 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 301 VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDM 365
Fly 366 SETAY-GNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQL--MAEAVRRLPPAH 427
Fly 428 HSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLI-----------ATPQHMTNLTEEIFMLS 481
Fly 482 SLITHCKTIF 491 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP5A | NP_727007.1 | SH2_a2chimerin_b2chimerin | 75..166 | CDD:198215 | |
C1_1 | 242..294 | CDD:278556 | |||
RhoGAP_chimaerin | 302..491 | CDD:239837 | 62/202 (31%) | ||
ARHGAP30 | NP_001020769.1 | RhoGAP_CdGAP | 16..210 | CDD:239849 | 61/198 (31%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 224..243 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 300..400 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 451..529 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 621..906 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 965..991 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1050..1101 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1300981at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |