DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and rga2

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_594152.1 Gene:rga2 / 2542682 PomBaseID:SPAC26A3.09c Length:1275 Species:Schizosaccharomyces pombe


Alignment Length:200 Identity:71/200 - (35%)
Similarity:103/200 - (51%) Gaps:16/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 RIRGVFGTDLTTMVQLEPHHQ---IPFVVRRCVEEVEA-RGMLQEGIYRVSGFADEIEALKLALD 357
            |..|:||..|...|.:.....   :|.||.||:|.:|: |...:|||||:||.|..|:.||...:
pombe  1058 RKSGIFGLPLNEAVNISTQFNDSGLPIVVYRCIEYLESCRAEKEEGIYRLSGSASTIKHLKEQFN 1122

  Fly   358 REGEKTD-MSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVR 421
             ||...| :|.....:|:||||.||||||.||..|:....:..|.........:.....:.:.:.
pombe  1123 -EGVDYDLLSSDEEFDVHVIAGLLKLYLRNLPTNLLDTSMHKLFELLPNVPNDSAALGELCDVIS 1186

  Fly   422 RLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEIFMLSSLITH 486
            :|||.:.:.|..:|.||:|:.:...|||||..|:..||:|||        |:..:|||:  ||.:
pombe  1187 KLPPENFALLDSLLHHLRRIIAFEKVNKMNIRNVCIVFSPTL--------NIPSDIFMM--LILN 1241

  Fly   487 CKTIF 491
            ...||
pombe  1242 YDHIF 1246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 67/193 (35%)
rga2NP_594152.1 PH-like 720..833 CDD:302622
PH 722..836 CDD:278594
RhoGAP_fBEM3 1062..1249 CDD:239865 68/195 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.