DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Arhgap9

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_001272714.1 Gene:Arhgap9 / 216445 MGIID:2143764 Length:648 Species:Mus musculus


Alignment Length:237 Identity:74/237 - (31%)
Similarity:115/237 - (48%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 SKCSELVPPKCVPDLKRI--RG-----VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEG 338
            :|...|:..:  |.|:.:  ||     |||..|.::.|.| ...:|..||.|||.|:.:|:..:|
Mouse   412 NKLKRLIAKR--PTLQSLQERGL
FRDQVFGCQLESLCQRE-GDTVPSFVRLCVEAVDKKGLDVDG 473

  Fly   339 IYRVSGFADEIEALKLALDRE---------------GE--KTDMSETAYGNVNVIAGTLKLYLRL 386
            ||||||....::.|:..:|||               |:  |.|:....:.:::|:.|.|||:.|.
Mouse   474 IYRVSGNLAVVQKLRFLVDRERAVTSDGRYMFPEQAGQEGKLDLDSAEWDDIHVVTGALKLFFRE 538

  Fly   387 LPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMN 451
            ||.||:.....|.|..|....:..:....:.:.:..||..:|..|:|:||||.||.:|...|:|.
Mouse   539 LPQPLVPALLLPDFRDALELSEPEQCLSKIQKLIDSLPRPNHDTLKYILEHLCRVIAHSDKNRMT 603

  Fly   452 EHNLATVFAPTLIATPQHMTNLTEEIFMLSSLITHCKTIFAT 493
            .|||..||.|||....|..:::...:|....|:......||:
Mouse   604 AHNLGIVFGPTLFRPEQEASDMAAHVFYPGQLVQLMLNNFAS 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 2/12 (17%)
RhoGAP_chimaerin 302..491 CDD:239837 65/205 (32%)
Arhgap9NP_001272714.1 SH3 26..82 CDD:302595
PH_ARHGAP9-like 236..349 CDD:270053
PH 250..348 CDD:278594
ASCH <346..432 CDD:294653 5/21 (24%)
RhoGAP_ARHGAP27_15_12_9 438..642 CDD:239868 65/204 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.