DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and Syde2

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_006501355.3 Gene:Syde2 / 214804 MGIID:3036264 Length:1315 Species:Mus musculus


Alignment Length:196 Identity:64/196 - (32%)
Similarity:101/196 - (51%) Gaps:11/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 DLKRIRGVFGTDLTTMVQLE-PHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALD 357
            |..|...:||.|:..:|:.| ....:|.::::|:.|:|.||....|:||:.|.|...:.|:.|.:
Mouse   928 DKNREAVMFGVDIQKVVEKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFE 992

  Fly   358 REGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAY----------PSFMAAGRTGKQAEQ 412
            ::.:...:.|..|.::|||.|.||.|||.||.||||.|.|          |..|::.....:...
Mouse   993 KDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSD 1057

  Fly   413 RQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEI 477
            .:|..:.:..||....:.|:.:|:|||.|||::.||||...|||..|.|.|:...|..:.....:
Mouse  1058 SRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLNQRQEASTHNNRV 1122

  Fly   478 F 478
            |
Mouse  1123 F 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 64/196 (33%)
RhoGAP_chimaerin 302..491 CDD:239837 62/188 (33%)
Syde2XP_006501355.3 PHA03379 <109..>326 CDD:223066
C2 801..916 CDD:387358
RhoGAP 936..1150 CDD:383032 62/188 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.