Sequence 1: | NP_727007.1 | Gene: | RhoGAP5A / 31473 | FlyBaseID: | FBgn0029778 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006501355.3 | Gene: | Syde2 / 214804 | MGIID: | 3036264 | Length: | 1315 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 64/196 - (32%) |
---|---|---|---|
Similarity: | 101/196 - (51%) | Gaps: | 11/196 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 294 DLKRIRGVFGTDLTTMVQLE-PHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALD 357
Fly 358 REGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAY----------PSFMAAGRTGKQAEQ 412
Fly 413 RQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEI 477
Fly 478 F 478 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP5A | NP_727007.1 | SH2_a2chimerin_b2chimerin | 75..166 | CDD:198215 | |
C1_1 | 242..294 | CDD:278556 | 64/196 (33%) | ||
RhoGAP_chimaerin | 302..491 | CDD:239837 | 62/188 (33%) | ||
Syde2 | XP_006501355.3 | PHA03379 | <109..>326 | CDD:223066 | |
C2 | 801..916 | CDD:387358 | |||
RhoGAP | 936..1150 | CDD:383032 | 62/188 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1300981at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |