DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and rga-3

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_504503.1 Gene:rga-3 / 178961 WormBaseID:WBGene00019600 Length:1085 Species:Caenorhabditis elegans


Alignment Length:199 Identity:48/199 - (24%)
Similarity:84/199 - (42%) Gaps:40/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 TMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMSETAYGN 372
            |.::|:   ::|..:......:...||..:||:|..|.:..:...::....:|::...::  |..
 Worm    58 TRIRLK---EVPKFIVNAFNIISKHGMDTDGIFRKEGNSVRLNRAEVQAIYKGQRDIPND--YSV 117

  Fly   373 VNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQ----------RQLMAE-------AV 420
            ::|.. .:|.:||.|..||:     .|.....|..|:|.|          |..||:       .:
 Worm   118 IDVCT-MVKRFLRDLKPPLL-----DSEECRARLLKKACQARISDGFLMTRDEMADVFYMEDRTI 176

  Fly   421 RRLPP----AHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIA--------TPQHMTNL 473
            .:..|    ||.|.|.|::..|.|:|:|...:||:..|||.||..::..        |||.....
 Worm   177 EQQTPLLSDAHASTLGYVMRQLNRIAAHSEQHKMSIENLAIVFIGSVFGDGIHDSKKTPQLRRGS 241

  Fly   474 TEEI 477
            .|:|
 Worm   242 KEDI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 48/199 (24%)
rga-3NP_504503.1 RhoGAP 63..232 CDD:214618 41/179 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1453
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.