Sequence 1: | NP_727007.1 | Gene: | RhoGAP5A / 31473 | FlyBaseID: | FBgn0029778 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_504503.1 | Gene: | rga-3 / 178961 | WormBaseID: | WBGene00019600 | Length: | 1085 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 48/199 - (24%) |
---|---|---|---|
Similarity: | 84/199 - (42%) | Gaps: | 40/199 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 308 TMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMSETAYGN 372
Fly 373 VNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQ----------RQLMAE-------AV 420
Fly 421 RRLPP----AHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIA--------TPQHMTNL 473
Fly 474 TEEI 477 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP5A | NP_727007.1 | SH2_a2chimerin_b2chimerin | 75..166 | CDD:198215 | |
C1_1 | 242..294 | CDD:278556 | |||
RhoGAP_chimaerin | 302..491 | CDD:239837 | 48/199 (24%) | ||
rga-3 | NP_504503.1 | RhoGAP | 63..232 | CDD:214618 | 41/179 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1453 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |