DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and T04C9.1

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_741163.2 Gene:T04C9.1 / 175849 WormBaseID:WBGene00020209 Length:881 Species:Caenorhabditis elegans


Alignment Length:192 Identity:56/192 - (29%)
Similarity:91/192 - (47%) Gaps:36/192 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 VRRCVEEVEARGMLQEGIYRVSGFADEIE-ALKLALDRE--GEKTDMSETAYGNVNV-------- 375
            |::|::.:|..|:.::|:||..|...::: .:.|.|||.  .||        |.:|:        
 Worm   413 VQQCIDILEESGIHEQGVYRNCGVTSKVQKMMMLGLDRRKASEK--------GGLNLRDDEWETK 469

  Fly   376 -IAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLK 439
             |:..:|.:||.||.||:||:.:..|:.|.:.|....:...:...|.:||..|...|:.::.|||
 Worm   470 TISSAVKTFLRNLPEPLMTFELHNVFINAAKMGDATMRIDHIHFYVHQLPAQHLRMLEIVVRHLK 534

  Fly   440 RVASHYAVNKMNEHNLATVFAPTLIATPQHMT----------NLTEEIFMLSSLITHCKTIF 491
            |||.....|.|...||...|.|||: .|:..|          |:..|:     ||::...||
 Worm   535 RVADLSNENLMTVSNLGVCFGPTLL-RPKEETVAAIMDIKFCNVVVEV-----LISNYDKIF 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556
RhoGAP_chimaerin 302..491 CDD:239837 54/190 (28%)
T04C9.1NP_741163.2 BAR_RhoGAP_OPHN1-like 19..225 CDD:153286
BAR-PH_GRAF_family 271..388 CDD:269953
RhoGAP 381..585 CDD:295372 54/185 (29%)
SH3_GRAF-like 826..879 CDD:212815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.