DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and spv-1

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_495666.4 Gene:spv-1 / 174278 WormBaseID:WBGene00014051 Length:966 Species:Caenorhabditis elegans


Alignment Length:269 Identity:77/269 - (28%)
Similarity:128/269 - (47%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 HHFK--VHTFKGLNWCEFCANFLWGFTAQGVKCEACGFVAHSKCSELVPPKCVPDLK---RIRGV 301
            ||.:  |...|    |..|......:|   |:|..||...|..|...:...|....|   |...:
 Worm   539 HHIQRTVQPSK----CSACDTLSILYT---VQCIDCGGQWHKACFPRIQQVCGQAAKLVDRRTSI 596

  Fly   302 FGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMS 366
            ||..|..:::.:..| ||.::.:.:::::.||:..:||||..|...:||.:..|.:|....   .
 Worm   597 FGVPLKGLLEHQNRH-IPLIIEKSIDQLQRRGLRAKGIYRTCGVKSKIEEICNAFERSSSD---D 657

  Fly   367 ETAYGNVNV--IAGTLKLYLRLLPVPLITFQAYPSFMAAG-------RTGKQAEQRQL--MAEAV 420
            |....|.|.  :|..:|||||.||.||:||:.|..|:..|       .:|...|:.::  :.:..
 Worm   658 EVCLDNENPMNLASVVKLYLRKLPEPLLTFELYDDFVRLGTECCSAQASGSNCEEERVEQLRQLA 722

  Fly   421 RRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLI-ATPQHM-----------TNL 473
            |:||..::..|::::.||.||:..:.||.|:..||:||.||:|| .:|:.:           ||.
 Worm   723 RKLPVHNYETLKFIMLHLNRVSWFHEVNLMSTSNLSTVIAPSLIWMSPKRIDHTSAIMHTQYTNK 787

  Fly   474 TEEIFMLSS 482
            ..|:.:.:|
 Worm   788 AIEVMIRNS 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 14/53 (26%)
RhoGAP_chimaerin 302..491 CDD:239837 61/204 (30%)
spv-1NP_495666.4 FCH 195..278 CDD:214492
C1 537..583 CDD:197519 13/50 (26%)
RhoGAP 610..796 CDD:214618 57/189 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1094
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.