DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP5A and ARHGAP33

DIOPT Version :9

Sequence 1:NP_727007.1 Gene:RhoGAP5A / 31473 FlyBaseID:FBgn0029778 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_006723062.1 Gene:ARHGAP33 / 115703 HGNCID:23085 Length:1298 Species:Homo sapiens


Alignment Length:366 Identity:99/366 - (27%)
Similarity:155/366 - (42%) Gaps:65/366 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 NCYQQSPYMTL--NGRKLRALSNEL-----GKAAAKESKESPAEEKEQKQEE--------PPPPA 230
            ||.....:|.|  :||:| .||.|.     ..|||...|...|:..::...|        ..||.
Human   158 NCGPVLTWMELDNHGRRL-LLSEEASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPT 221

  Fly   231 VDPMPLVYEKPHHFKVHTFKGLNWCEFCANFLWGFTAQGVKC-----EACGFVAHSKCSEL---V 287
            .|..  .:.....|:|..|.     ..|..........|:|.     ..||..|....|.|   |
Human   222 EDRS--WWRGKRGFQVGFFP-----SECVELFTERPGPGLKAADADGPPCGIPAPQGISSLTSAV 279

  Fly   288 P-------------PKCVPDLKRIR-------GVFGTDLTTMVQLEPHHQIPFVVRRCVEEVEAR 332
            |             .:..|..:|:|       .|||.||...:. .....:|.|:|.|.|.:||.
Human   280 PRPRGKLAGLLRTFMRSRPSRQRLRQRGILRQRVFGCDLGEHLS-NSGQDVPQVLRCCSEFIEAH 343

  Fly   333 GMLQEGIYRVSGFADEIEALKLALDREGEKTDMSETAY-GNVNVIAGTLKLYLRLLPVPLITFQA 396
            |:: :||||:||.:..|:.|:...|.| ...::|..|: .:::.::...|||.|.||.||:|:|.
Human   344 GVV-DGIYRLSGVSSNIQRLRHEFDSE-RIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQL 406

  Fly   397 YPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAP 461
            |..|..|.....:.|:...:.:.:::|||.|:..|:|:|.||.|:|.|.|...|:..|||.|:||
Human   407 YGKFSEAMSVPGEEERLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAP 471

  Fly   462 TLIATPQ----------HMTNLTEEIFMLSSLITHCKTIFA 492
            .|:.:.:          ....:..:..::..|:||...:|:
Human   472 NLLRSMELESVGMGGAAAFREVRVQSVVVEFLLTHVDVLFS 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP5ANP_727007.1 SH2_a2chimerin_b2chimerin 75..166 CDD:198215
C1_1 242..294 CDD:278556 13/72 (18%)
RhoGAP_chimaerin 302..491 CDD:239837 62/199 (31%)
ARHGAP33XP_006723062.1 PX_domain 56..168 CDD:295365 3/9 (33%)
SH3_ARHGAP32_33 190..243 CDD:212769 11/59 (19%)
RhoGAP_CdGAP 312..506 CDD:239849 61/196 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300981at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.